A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10014
Swiss-prot Accession number	P06298 (Sequence in FASTA format)
Description	Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29879
References	1  PubMed abstract 3754961 2  PubMed abstract 1584015 3   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 3840481 5  PubMed abstract 2564347 6  PubMed abstract 3754961 7  PubMed abstract 1584015 8   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 3840481 10  PubMed abstract 2564347
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	NGNYRMHHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	17 Residues from position (210-226)
Receptor	N/A
Gene ID	380532
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10308
Swiss-prot Accession number	Q00643 (Sequence in FASTA format)
Description	Thyroliberin type B precursor [Contains: Prothyroliberin type B;Thyroliberin (Thyrotropin-releasing hormone) (TRH) (Thyrotropin-releasing factor) (TRF) (TSH-releasing factor) (Protirelin)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the TRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	224 Amino acids
Molecular weight	26148
References	1  PubMed abstract 1537407
Domain Name	TRH
Hormone Name	Thyroliberin
Mature Hormone Sequence	QHP
Position of mature hormone in Pre-Hormone protein	3 Residues from position (75-77)
Receptor	Q8JFZ6   Detail in HMRbase    Q9DDR0   Detail in HMRbase    Q9DDR1    Detail in HMRbase
Gene ID	373666
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	10519
Swiss-prot Accession number	P12856 (Sequence in FASTA format)
Description	Somatotropin B precursor (Growth hormone B) (GH-B).
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control
Protein Length	208 Amino acids
Molecular weight	24074
References	1  PubMed abstract 10618393 2  PubMed abstract 2734108
Domain Name	Hormone_1
Hormone Name	Somatotropin-B
Mature Hormone Sequence	FPNVPLFSLFTNAVNRAQHLHMLAADIYKDYERTYITDDVRRSSKNSQVVSCYSENIPAPTDKDNTHLKSDMDLLRFSLTLIQSWLNPVQALHRLFRNSDVYERLKYLEEGIQSLIRELEDGNLRSYSFMRTPYERLDINMRTDDGLLKVYGLLSCFKKDMHKVETYMKVIKCRHFAESKCVI
Position of mature hormone in Pre-Hormone protein	183 Residues from position (26-208)
Receptor	N/A
Gene ID	373617
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10714
Swiss-prot Accession number	P12855 (Sequence in FASTA format)
Description	Somatotropin A precursor (Growth hormone A) (GH-A).
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control
Protein Length	214 Amino acids
Molecular weight	24700
References	1  PubMed abstract 10618393 2  PubMed abstract 2734108
Domain Name	Hormone_1
Hormone Name	Somatotropin-A
Mature Hormone Sequence	FPSVPLFSLFTNAVSRAQYIHMLAADTYRDYERTYITDEQRHSNKNSHVVSCYSETIPYPTDKDNTHQKSDLELLRFSLNLIQSWLNPVQALNKVFSNNLVFGSSDVYERLKYLEEGIQALMQELEDGSFRSFPFLRPPYERFDINLRSDDALVKVYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTI
Position of mature hormone in Pre-Hormone protein	189 Residues from position (26-214)
Receptor	N/A
Gene ID	399154
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10916
Swiss-prot Accession number	P06298 (Sequence in FASTA format)
Description	Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29879
References	1  PubMed abstract 3754961 2  PubMed abstract 1584015 3   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 3840481 5  PubMed abstract 2564347 6  PubMed abstract 3754961 7  PubMed abstract 1584015 8   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 3840481 10  PubMed abstract 2564347
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMTHFRWNKF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (76-86)
Receptor	N/A
Gene ID	380532
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10917
Swiss-prot Accession number	P06298 (Sequence in FASTA format)
Description	Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29879
References	1  PubMed abstract 3754961 2  PubMed abstract 1584015 3   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 3840481 5  PubMed abstract 2564347 6  PubMed abstract 3754961 7  PubMed abstract 1584015 8   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 3840481 10  PubMed abstract 2564347
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	AYSMEHFRWGKPVGRKRRPIKVYPNGVEEESAESYPMEL
Position of mature hormone in Pre-Hormone protein	39 Residues from position (140-178)
Receptor	N/A
Gene ID	380532
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10918
Swiss-prot Accession number	P06298 (Sequence in FASTA format)
Description	Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29879
References	1  PubMed abstract 3754961 2  PubMed abstract 1584015 3   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 3840481 5  PubMed abstract 2564347 6  PubMed abstract 3754961 7  PubMed abstract 1584015 8   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 3840481 10  PubMed abstract 2564347
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	AYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (140-152)
Receptor	N/A
Gene ID	380532
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10919
Swiss-prot Accession number	P06298 (Sequence in FASTA format)
Description	Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29879
References	1  PubMed abstract 3754961 2  PubMed abstract 1584015 3   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 3840481 5  PubMed abstract 2564347 6  PubMed abstract 3754961 7  PubMed abstract 1584015 8   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 3840481 10  PubMed abstract 2564347
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELSLELDYPEIDLDEDIEDNEVESALTKKNGNYRMHHFRWGSPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNSHKKGQ
Position of mature hormone in Pre-Hormone protein	79 Residues from position (181-259)
Receptor	N/A
Gene ID	380532
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10920
Swiss-prot Accession number	P06298 (Sequence in FASTA format)
Description	Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29879
References	1  PubMed abstract 3754961 2  PubMed abstract 1584015 3   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 3840481 5  PubMed abstract 2564347 6  PubMed abstract 3754961 7  PubMed abstract 1584015 8   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 3840481 10  PubMed abstract 2564347
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELSLELDYPEIDLDEDIEDNEVESALTKKNGNYRMHHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	46 Residues from position (181-226)
Receptor	N/A
Gene ID	380532
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10921
Swiss-prot Accession number	P06298 (Sequence in FASTA format)
Description	Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29879
References	1  PubMed abstract 3754961 2  PubMed abstract 1584015 3   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 3840481 5  PubMed abstract 2564347 6  PubMed abstract 3754961 7  PubMed abstract 1584015 8   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 3840481 10  PubMed abstract 2564347
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTPERSQTPLMTLFKNAIIKNSHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (229-259)
Receptor	N/A
Gene ID	380532
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10922
Swiss-prot Accession number	P06298 (Sequence in FASTA format)
Description	Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29879
References	1  PubMed abstract 3754961 2  PubMed abstract 1584015 3   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 3840481 5  PubMed abstract 2564347 6  PubMed abstract 3754961 7  PubMed abstract 1584015 8   Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 3840481 10  PubMed abstract 2564347
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (229-233)
Receptor	N/A
Gene ID	380532
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	11066
Swiss-prot Accession number	P18758 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) (Thymosin beta 4Xen).
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Spleen, kidney, heart, and oocytes
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5097
References	1  PubMed abstract 1567461 2  PubMed abstract 3124756
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKAKLKKTETQEKNPLPSKETIEQEKQTSES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	399438
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	11228
Swiss-prot Accession number	O42143 (Sequence in FASTA format)
Description	Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	266 Amino acids
Molecular weight	30951
References	1  PubMed abstract 9223287
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (53-81)
Receptor	Q8UVY5    Detail in HMRbase
Gene ID	373686
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 14

HMRbase accession number	11229
Swiss-prot Accession number	O42143 (Sequence in FASTA format)
Description	Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	266 Amino acids
Molecular weight	30951
References	1  PubMed abstract 9223287
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1A
Mature Hormone Sequence	HAEGTFTSDVTQQLDEKAAKEFIDWLINGGPSKEIIS
Position of mature hormone in Pre-Hormone protein	37 Residues from position (97-133)
Receptor	Q8UVY5    Detail in HMRbase
Gene ID	373686
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 15

HMRbase accession number	11230
Swiss-prot Accession number	O42143 (Sequence in FASTA format)
Description	Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	266 Amino acids
Molecular weight	30951
References	1  PubMed abstract 9223287
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1B
Mature Hormone Sequence	HAEGTYTNDVTEYLEEKAAKEFIEWLIKGKP
Position of mature hormone in Pre-Hormone protein	31 Residues from position (142-172)
Receptor	Q8UVY5    Detail in HMRbase
Gene ID	373686
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 16

HMRbase accession number	11231
Swiss-prot Accession number	O42143 (Sequence in FASTA format)
Description	Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	266 Amino acids
Molecular weight	30951
References	1  PubMed abstract 9223287
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1C
Mature Hormone Sequence	HAEGTFTNDMTNYLEEKAAKEFVGWLIKGRP
Position of mature hormone in Pre-Hormone protein	31 Residues from position (180-210)
Receptor	Q8UVY5    Detail in HMRbase
Gene ID	373686
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 17

HMRbase accession number	11232
Swiss-prot Accession number	O42143 (Sequence in FASTA format)
Description	Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	266 Amino acids
Molecular weight	30951
References	1  PubMed abstract 9223287
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFTNDINKVLDIIAAQEFLDWVINTQETE
Position of mature hormone in Pre-Hormone protein	33 Residues from position (227-259)
Receptor	Q8UVY5    Detail in HMRbase
Gene ID	373686
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 18

HMRbase accession number	11245
Swiss-prot Accession number	P01152 (Sequence in FASTA format)
Description	Thyroliberin type A precursor [Contains: Prothyroliberin type A;Thyroliberin (Thyrotropin-releasing hormone) (TRH) (Thyrotropin-releasing factor) (TRF) (TSH-releasing factor) (Protirelin)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the TRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	227 Amino acids
Molecular weight	26336
References	1  PubMed abstract 1694847 2  PubMed abstract 6425056
Domain Name	TRH
Hormone Name	Thyroliberin
Mature Hormone Sequence	QHP
Position of mature hormone in Pre-Hormone protein	3 Residues from position (75-77)
Receptor	Q8JFZ6   Detail in HMRbase    Q9DDR0   Detail in HMRbase    Q9DDR1    Detail in HMRbase
Gene ID	397780
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 19

HMRbase accession number	11402
Swiss-prot Accession number	P12706 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	106 Amino acids
Molecular weight	12170
References	1  PubMed abstract 2722842 2  PubMed abstract 2661211
Domain Name	Insulin
Hormone Name	Insulin-1 B chain
Mature Hormone Sequence	LVNQHLCGSHLVEALYLVCGDRGFFYYPKV
Position of mature hormone in Pre-Hormone protein	30 Residues from position (24-53)
Receptor	Q9PVZ4    Detail in HMRbase
Gene ID	378696
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 20

HMRbase accession number	11403
Swiss-prot Accession number	P12706 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	106 Amino acids
Molecular weight	12170
References	1  PubMed abstract 2722842 2  PubMed abstract 2661211
Domain Name	Insulin
Hormone Name	Insulin-1 A chain
Mature Hormone Sequence	GIVEQCCHSTCSLFQLESYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (86-106)
Receptor	Q9PVZ4    Detail in HMRbase
Gene ID	378696
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 21

HMRbase accession number	11404
Swiss-prot Accession number	P12707 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	106 Amino acids
Molecular weight	12207
References	1  PubMed abstract 2722842 2  PubMed abstract 2661211
Domain Name	Insulin
Hormone Name	Insulin-2 B chain
Mature Hormone Sequence	LANQHLCGSHLVEALYLVCGDRGFFYYPKI
Position of mature hormone in Pre-Hormone protein	30 Residues from position (24-53)
Receptor	Q9PVZ4    Detail in HMRbase
Gene ID	378695
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 22

HMRbase accession number	11405
Swiss-prot Accession number	P12707 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	106 Amino acids
Molecular weight	12207
References	1  PubMed abstract 2722842 2  PubMed abstract 2661211
Domain Name	Insulin
Hormone Name	Insulin-2 A chain
Mature Hormone Sequence	GIVEQCCHSTCSLFQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (86-106)
Receptor	Q9PVZ4    Detail in HMRbase
Gene ID	378695
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 23

HMRbase accession number	11460
Swiss-prot Accession number	P45656 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); Gonadotropin-releasing hormone-associated peptide;GnRH-associated peptide 1 (GnRH-associated peptide I)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	89 Amino acids
Molecular weight	10246
References	1  PubMed abstract 8137750
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLRPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	Q9I8V4    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 24

HMRbase accession number	11467
Swiss-prot Accession number	P49188 (Sequence in FASTA format)
Description	Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone).
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This hormone from hypothalamus regulates the release of corticotropin from pituitary gland
Protein Length	162 Amino acids
Molecular weight	17880
References	1  PubMed abstract 1448118 2   Yao M., Stenzel-Poore M.P., Denver R.J.; "Structural and functional analysis of corticotropin-releasing factorgenes of the South African clawed frog, Xenopus laevis."; Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	CRF
Hormone Name	Corticoliberin
Mature Hormone Sequence	AEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII
Position of mature hormone in Pre-Hormone protein	41 Residues from position (120-160)
Receptor	O42602   Detail in HMRbase    O42603    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 25

HMRbase accession number	11471
Swiss-prot Accession number	P50144 (Sequence in FASTA format)
Description	Cholecystokinin type 1 precursor [Contains: Cholecystokinin (CCK)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Brain, gastrointestinal tract and lung
Post translational modification	N/A
Function	N/A
Protein Length	123 Amino acids
Molecular weight	13943
References	1  PubMed abstract 7669225
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (104-111)
Receptor	P70031    Detail in HMRbase
Gene ID	378611
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 26

HMRbase accession number	11472
Swiss-prot Accession number	P50145 (Sequence in FASTA format)
Description	Cholecystokinin type 2 precursor [Contains: Cholecystokinin (CCK)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Brain and gastrointestinal tract
Post translational modification	N/A
Function	N/A
Protein Length	128 Amino acids
Molecular weight	14201
References	1  PubMed abstract 7669225
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (109-116)
Receptor	P70031    Detail in HMRbase
Gene ID	378612
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 27

HMRbase accession number	11570
Swiss-prot Accession number	Q563I5 (Sequence in FASTA format)
Description	Leptin; Precursor
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	169 Amino acids
Molecular weight	19413
References	1  PubMed abstract 16782821
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	734226
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated